Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,408
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,388
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 10,325
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,309
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,291
  6. Avatar for Contenders 6. Contenders 14 pts. 10,226
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,196
  8. Avatar for Russian team 8. Russian team 5 pts. 10,163
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,148
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 10,095
  1. Avatar for silent gene 31. silent gene Lv 1 24 pts. 10,023
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 23 pts. 10,011
  3. Avatar for fpc 33. fpc Lv 1 22 pts. 10,004
  4. Avatar for drumpeter18yrs9yrs 34. drumpeter18yrs9yrs Lv 1 21 pts. 9,971
  5. Avatar for guineapig 35. guineapig Lv 1 19 pts. 9,968
  6. Avatar for MicElephant 36. MicElephant Lv 1 18 pts. 9,933
  7. Avatar for WBarme1234 37. WBarme1234 Lv 1 17 pts. 9,885
  8. Avatar for O Seki To 38. O Seki To Lv 1 16 pts. 9,855
  9. Avatar for joremen 39. joremen Lv 1 15 pts. 9,849
  10. Avatar for pvc78 40. pvc78 Lv 1 15 pts. 9,845

Comments