Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,855
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,608
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,024
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,815
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 7,405
  6. Avatar for Team China 16. Team China 1 pt. 7,187
  1. Avatar for Old Chap 81. Old Chap Lv 1 1 pt. 8,158
  2. Avatar for Datstandin 82. Datstandin Lv 1 1 pt. 8,150
  3. Avatar for cbwest 83. cbwest Lv 1 1 pt. 8,094
  4. Avatar for claatou 84. claatou Lv 1 1 pt. 8,090
  5. Avatar for Simek 85. Simek Lv 1 1 pt. 8,078
  6. Avatar for cobaltteal 86. cobaltteal Lv 1 1 pt. 8,005
  7. Avatar for Louchat78 87. Louchat78 Lv 1 1 pt. 7,888
  8. Avatar for kevin everington 88. kevin everington Lv 1 1 pt. 7,885
  9. Avatar for boondog 89. boondog Lv 1 1 pt. 7,793
  10. Avatar for abiogenesis 90. abiogenesis Lv 1 1 pt. 7,767

Comments