Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,408
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,388
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 10,325
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,309
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,291
  6. Avatar for Contenders 6. Contenders 14 pts. 10,226
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,196
  8. Avatar for Russian team 8. Russian team 5 pts. 10,163
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,148
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 10,095
  1. Avatar for alwen 41. alwen Lv 1 14 pts. 9,833
  2. Avatar for manu8170 42. manu8170 Lv 1 13 pts. 9,812
  3. Avatar for TastyMunchies 43. TastyMunchies Lv 1 12 pts. 9,806
  4. Avatar for Vinara 44. Vinara Lv 1 11 pts. 9,794
  5. Avatar for diamonddays 45. diamonddays Lv 1 11 pts. 9,776
  6. Avatar for Vincera 46. Vincera Lv 1 10 pts. 9,680
  7. Avatar for heather-1 47. heather-1 Lv 1 9 pts. 9,654
  8. Avatar for johngran 48. johngran Lv 1 9 pts. 9,635
  9. Avatar for haabermaaster 49. haabermaaster Lv 1 8 pts. 9,608
  10. Avatar for Hellcat6 50. Hellcat6 Lv 1 8 pts. 9,582

Comments