Placeholder image of a protein
Icon representing a puzzle

1771: Revisiting Puzzle 83: Cardiotoxin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 10, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,408
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,388
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 10,325
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,309
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,291
  6. Avatar for Contenders 6. Contenders 14 pts. 10,226
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 10,196
  8. Avatar for Russian team 8. Russian team 5 pts. 10,163
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,148
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 10,095
  1. Avatar for Arne Heessels 61. Arne Heessels Lv 1 4 pts. 8,881
  2. Avatar for rabamino12358 62. rabamino12358 Lv 1 3 pts. 8,871
  3. Avatar for JasperD 63. JasperD Lv 1 3 pts. 8,868
  4. Avatar for hansvandenhof 64. hansvandenhof Lv 1 3 pts. 8,846
  5. Avatar for harvardman 65. harvardman Lv 1 3 pts. 8,817
  6. Avatar for Steven Pletsch 66. Steven Pletsch Lv 1 3 pts. 8,815
  7. Avatar for PeterDav 67. PeterDav Lv 1 2 pts. 8,769
  8. Avatar for Pawel Tluscik 68. Pawel Tluscik Lv 1 2 pts. 8,767
  9. Avatar for pfirth 69. pfirth Lv 1 2 pts. 8,707
  10. Avatar for detectorist 70. detectorist Lv 1 2 pts. 8,644

Comments