Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,386
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,323
  3. Avatar for Russian team 13. Russian team 1 pt. 9,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,129
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,804
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,434
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,229
  8. Avatar for Team New Zealand 18. Team New Zealand 1 pt. 7,998
  1. Avatar for fiendish_ghoul 31. fiendish_ghoul Lv 1 20 pts. 9,472
  2. Avatar for Idiotboy 32. Idiotboy Lv 1 19 pts. 9,438
  3. Avatar for Vinara 33. Vinara Lv 1 18 pts. 9,417
  4. Avatar for CAN1958 34. CAN1958 Lv 1 17 pts. 9,406
  5. Avatar for versat82 35. versat82 Lv 1 16 pts. 9,393
  6. Avatar for O Seki To 36. O Seki To Lv 1 15 pts. 9,386
  7. Avatar for SiliconDioxide 37. SiliconDioxide Lv 1 14 pts. 9,379
  8. Avatar for joremen 38. joremen Lv 1 13 pts. 9,347
  9. Avatar for drumpeter18yrs9yrs 39. drumpeter18yrs9yrs Lv 1 12 pts. 9,325
  10. Avatar for vuvuvu 40. vuvuvu Lv 1 11 pts. 9,323

Comments