Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,916
  2. Avatar for Go Science 2. Go Science 74 pts. 9,907
  3. Avatar for Contenders 3. Contenders 54 pts. 9,827
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,824
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,745
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,734
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,684
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,663
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,509
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 3 pts. 9,393
  1. Avatar for fiendish_ghoul 31. fiendish_ghoul Lv 1 20 pts. 9,472
  2. Avatar for Idiotboy 32. Idiotboy Lv 1 19 pts. 9,438
  3. Avatar for Vinara 33. Vinara Lv 1 18 pts. 9,417
  4. Avatar for CAN1958 34. CAN1958 Lv 1 17 pts. 9,406
  5. Avatar for versat82 35. versat82 Lv 1 16 pts. 9,393
  6. Avatar for O Seki To 36. O Seki To Lv 1 15 pts. 9,386
  7. Avatar for SiliconDioxide 37. SiliconDioxide Lv 1 14 pts. 9,379
  8. Avatar for joremen 38. joremen Lv 1 13 pts. 9,347
  9. Avatar for drumpeter18yrs9yrs 39. drumpeter18yrs9yrs Lv 1 12 pts. 9,325
  10. Avatar for vuvuvu 40. vuvuvu Lv 1 11 pts. 9,323

Comments