Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 6 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 2 pts. 9,386
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,323
  3. Avatar for Russian team 13. Russian team 1 pt. 9,218
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,129
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,804
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,434
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,229
  8. Avatar for Team New Zealand 18. Team New Zealand 1 pt. 7,998
  1. Avatar for Glen B 41. Glen B Lv 1 10 pts. 9,317
  2. Avatar for pauldunn 42. pauldunn Lv 1 10 pts. 9,298
  3. Avatar for Hellcat6 43. Hellcat6 Lv 1 9 pts. 9,292
  4. Avatar for jausmh 44. jausmh Lv 1 8 pts. 9,268
  5. Avatar for hansvandenhof 45. hansvandenhof Lv 1 8 pts. 9,261
  6. Avatar for Silvercraft 46. Silvercraft Lv 1 7 pts. 9,245
  7. Avatar for guineapig 47. guineapig Lv 1 7 pts. 9,221
  8. Avatar for vakobo 48. vakobo Lv 1 6 pts. 9,218
  9. Avatar for detectorist 49. detectorist Lv 1 6 pts. 9,186
  10. Avatar for cbwest 50. cbwest Lv 1 5 pts. 9,185

Comments