Placeholder image of a protein
Icon representing a puzzle

1777: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
December 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,916
  2. Avatar for Go Science 2. Go Science 74 pts. 9,907
  3. Avatar for Contenders 3. Contenders 54 pts. 9,827
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,824
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 9,745
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,734
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,684
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 9,663
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 5 pts. 9,509
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 3 pts. 9,393
  1. Avatar for Glen B 41. Glen B Lv 1 10 pts. 9,317
  2. Avatar for pauldunn 42. pauldunn Lv 1 10 pts. 9,298
  3. Avatar for Hellcat6 43. Hellcat6 Lv 1 9 pts. 9,292
  4. Avatar for jausmh 44. jausmh Lv 1 8 pts. 9,268
  5. Avatar for hansvandenhof 45. hansvandenhof Lv 1 8 pts. 9,261
  6. Avatar for Silvercraft 46. Silvercraft Lv 1 7 pts. 9,245
  7. Avatar for guineapig 47. guineapig Lv 1 7 pts. 9,221
  8. Avatar for vakobo 48. vakobo Lv 1 6 pts. 9,218
  9. Avatar for detectorist 49. detectorist Lv 1 6 pts. 9,186
  10. Avatar for cbwest 50. cbwest Lv 1 5 pts. 9,185

Comments