Placeholder image of a protein
Icon representing a puzzle

1780: Revisiting Puzzle 86: Nematode

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
December 31, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 10,241
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,051
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,865
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,814
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,349
  6. Avatar for uneRx 16. uneRx 1 pt. 7,460
  7. Avatar for Team New Zealand 17. Team New Zealand 1 pt. 6,469
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 4,094
  1. Avatar for MicElephant 31. MicElephant Lv 1 21 pts. 10,520
  2. Avatar for Vinara 32. Vinara Lv 1 20 pts. 10,516
  3. Avatar for guineapig 33. guineapig Lv 1 18 pts. 10,473
  4. Avatar for manu8170 34. manu8170 Lv 1 17 pts. 10,419
  5. Avatar for alwen 35. alwen Lv 1 16 pts. 10,334
  6. Avatar for heather-1 36. heather-1 Lv 1 15 pts. 10,327
  7. Avatar for haabermaaster 37. haabermaaster Lv 1 14 pts. 10,314
  8. Avatar for Anfinsen_slept_here 38. Anfinsen_slept_here Lv 1 13 pts. 10,278
  9. Avatar for Silvercraft 39. Silvercraft Lv 1 13 pts. 10,272
  10. Avatar for stomjoh 40. stomjoh Lv 1 12 pts. 10,262

Comments