Placeholder image of a protein
Icon representing a puzzle

1789: Revisiting Puzzle 89: Cow Eye

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,676
  2. Avatar for Team New Zealand 12. Team New Zealand 1 pt. 10,493
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,306
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 10,251
  5. Avatar for 2022_MUfolders 15. 2022_MUfolders 1 pt. 9,784
  6. Avatar for Team China 16. Team China 1 pt. 9,713
  7. Avatar for Russian team 17. Russian team 1 pt. 9,639
  8. Avatar for :) 18. :) 1 pt. 9,559
  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 29 pts. 11,085
  2. Avatar for phi16 32. phi16 Lv 1 27 pts. 11,084
  3. Avatar for joremen 33. joremen Lv 1 26 pts. 11,071
  4. Avatar for jobo0502 34. jobo0502 Lv 1 25 pts. 11,069
  5. Avatar for fiendish_ghoul 35. fiendish_ghoul Lv 1 24 pts. 11,068
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 23 pts. 11,060
  7. Avatar for NinjaGreg 37. NinjaGreg Lv 1 21 pts. 11,057
  8. Avatar for Enzyme 38. Enzyme Lv 1 20 pts. 11,040
  9. Avatar for alwen 39. alwen Lv 1 19 pts. 11,036
  10. Avatar for Blipperman 40. Blipperman Lv 1 18 pts. 11,034

Comments