Placeholder image of a protein
Icon representing a puzzle

1789: Revisiting Puzzle 89: Cow Eye

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 21, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for HMT heritage
    1. HMT heritage
    100 pts. 11,332
  2. Avatar for Go Science 2. Go Science 74 pts. 11,289
  3. Avatar for Contenders 3. Contenders 54 pts. 11,288
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,285
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 11,254
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 11,210
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 11,191
  8. Avatar for Gargleblasters 8. Gargleblasters 8 pts. 11,168
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 11,103
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 10,958
  1. Avatar for dcrwheeler 31. dcrwheeler Lv 1 29 pts. 11,085
  2. Avatar for phi16 32. phi16 Lv 1 27 pts. 11,084
  3. Avatar for joremen 33. joremen Lv 1 26 pts. 11,071
  4. Avatar for jobo0502 34. jobo0502 Lv 1 25 pts. 11,069
  5. Avatar for fiendish_ghoul 35. fiendish_ghoul Lv 1 24 pts. 11,068
  6. Avatar for WBarme1234 36. WBarme1234 Lv 1 23 pts. 11,060
  7. Avatar for NinjaGreg 37. NinjaGreg Lv 1 21 pts. 11,057
  8. Avatar for Enzyme 38. Enzyme Lv 1 20 pts. 11,040
  9. Avatar for alwen 39. alwen Lv 1 19 pts. 11,036
  10. Avatar for Blipperman 40. Blipperman Lv 1 18 pts. 11,034

Comments