Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Deleted group 17. Deleted group pts. 0

  1. Avatar for zgf2022 91. zgf2022 Lv 1 1 pt. 8,554
  2. Avatar for alyssa_d_V2.0 92. alyssa_d_V2.0 Lv 1 1 pt. 8,541
  3. Avatar for gurch 93. gurch Lv 1 1 pt. 8,522
  4. Avatar for vuvuvu 94. vuvuvu Lv 1 1 pt. 8,508
  5. Avatar for dahast.de 95. dahast.de Lv 1 1 pt. 8,496
  6. Avatar for doui013 96. doui013 Lv 1 1 pt. 8,484
  7. Avatar for wisky 97. wisky Lv 1 1 pt. 8,476
  8. Avatar for WolverineX 98. WolverineX Lv 1 1 pt. 8,466
  9. Avatar for Orbiz 99. Orbiz Lv 1 1 pt. 8,436
  10. Avatar for Old Chap 100. Old Chap Lv 1 1 pt. 8,423

Comments