Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,842
  2. Avatar for Go Science 2. Go Science 73 pts. 9,819
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,775
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,765
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,729
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,722
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,650
  8. Avatar for Contenders 8. Contenders 6 pts. 9,591
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 9,550
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,262
  1. Avatar for zgf2022 91. zgf2022 Lv 1 1 pt. 8,554
  2. Avatar for alyssa_d_V2.0 92. alyssa_d_V2.0 Lv 1 1 pt. 8,541
  3. Avatar for gurch 93. gurch Lv 1 1 pt. 8,522
  4. Avatar for vuvuvu 94. vuvuvu Lv 1 1 pt. 8,508
  5. Avatar for dahast.de 95. dahast.de Lv 1 1 pt. 8,496
  6. Avatar for doui013 96. doui013 Lv 1 1 pt. 8,484
  7. Avatar for wisky 97. wisky Lv 1 1 pt. 8,476
  8. Avatar for WolverineX 98. WolverineX Lv 1 1 pt. 8,466
  9. Avatar for Orbiz 99. Orbiz Lv 1 1 pt. 8,436
  10. Avatar for Old Chap 100. Old Chap Lv 1 1 pt. 8,423

Comments