Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Bio 46 - Tufts University - Sp20 16. Bio 46 - Tufts University - Sp20 1 pt. 7,769
  7. Avatar for Deleted group 17. Deleted group pts. 0
  1. Avatar for le-hu 121. le-hu Lv 1 1 pt. 7,983
  2. Avatar for jung woo 122. jung woo Lv 1 1 pt. 7,898
  3. Avatar for HavocOrder0999 123. HavocOrder0999 Lv 1 1 pt. 7,898
  4. Avatar for Wipf 124. Wipf Lv 1 1 pt. 7,843
  5. Avatar for Knoblerine 125. Knoblerine Lv 1 1 pt. 7,814
  6. Avatar for Xenom Apperance 126. Xenom Apperance Lv 1 1 pt. 7,804
  7. Avatar for eiliu 127. eiliu Lv 1 1 pt. 7,769
  8. Avatar for MatthsterFolder 128. MatthsterFolder Lv 1 1 pt. 7,664
  9. Avatar for hklenc 129. hklenc Lv 1 1 pt. 7,620
  10. Avatar for locytus 130. locytus Lv 1 1 pt. 7,609

Comments