Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Void Crushers 100 pts. 9,842
  2. Avatar for Go Science 2. Go Science 73 pts. 9,819
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,775
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,765
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,729
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,722
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,650
  8. Avatar for Contenders 8. Contenders 6 pts. 9,591
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 9,550
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,262

  1. Avatar for le-hu 121. le-hu Lv 1 1 pt. 7,983
  2. Avatar for jung woo 122. jung woo Lv 1 1 pt. 7,898
  3. Avatar for HavocOrder0999 123. HavocOrder0999 Lv 1 1 pt. 7,898
  4. Avatar for Wipf 124. Wipf Lv 1 1 pt. 7,843
  5. Avatar for Knoblerine 125. Knoblerine Lv 1 1 pt. 7,814
  6. Avatar for Xenom Apperance 126. Xenom Apperance Lv 1 1 pt. 7,804
  7. Avatar for eiliu 127. eiliu Lv 1 1 pt. 7,769
  8. Avatar for MatthsterFolder 128. MatthsterFolder Lv 1 1 pt. 7,664
  9. Avatar for hklenc 129. hklenc Lv 1 1 pt. 7,620
  10. Avatar for locytus 130. locytus Lv 1 1 pt. 7,609

Comments