Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Bio 46 - Tufts University - Sp20 16. Bio 46 - Tufts University - Sp20 1 pt. 7,769
  7. Avatar for Deleted group 17. Deleted group pts. 0
  1. Avatar for nicobul 21. nicobul Lv 1 49 pts. 9,662
  2. Avatar for O Seki To 22. O Seki To Lv 1 47 pts. 9,650
  3. Avatar for grogar7 23. grogar7 Lv 1 45 pts. 9,640
  4. Avatar for joremen 24. joremen Lv 1 43 pts. 9,630
  5. Avatar for RockOn 25. RockOn Lv 1 42 pts. 9,595
  6. Avatar for crpainter 26. crpainter Lv 1 40 pts. 9,591
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 39 pts. 9,581
  8. Avatar for Deleted player 28. Deleted player pts. 9,573
  9. Avatar for pvc78 29. pvc78 Lv 1 36 pts. 9,565
  10. Avatar for 181818 30. 181818 Lv 1 34 pts. 9,565

Comments