Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,842
  2. Avatar for Go Science 2. Go Science 73 pts. 9,819
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,775
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,765
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,729
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,722
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,650
  8. Avatar for Contenders 8. Contenders 6 pts. 9,591
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 9,550
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,262
  1. Avatar for nicobul 21. nicobul Lv 1 49 pts. 9,662
  2. Avatar for O Seki To 22. O Seki To Lv 1 47 pts. 9,650
  3. Avatar for grogar7 23. grogar7 Lv 1 45 pts. 9,640
  4. Avatar for joremen 24. joremen Lv 1 43 pts. 9,630
  5. Avatar for RockOn 25. RockOn Lv 1 42 pts. 9,595
  6. Avatar for crpainter 26. crpainter Lv 1 40 pts. 9,591
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 39 pts. 9,581
  8. Avatar for Deleted player 28. Deleted player pts. 9,573
  9. Avatar for pvc78 29. pvc78 Lv 1 36 pts. 9,565
  10. Avatar for 181818 30. 181818 Lv 1 34 pts. 9,565

Comments