Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Deleted group 17. Deleted group pts. 0

  1. Avatar for aznarog 41. aznarog Lv 1 21 pts. 9,445
  2. Avatar for Silvercraft 42. Silvercraft Lv 1 20 pts. 9,430
  3. Avatar for jausmh 43. jausmh Lv 1 19 pts. 9,410
  4. Avatar for Vinara 44. Vinara Lv 1 18 pts. 9,390
  5. Avatar for diamonddays 45. diamonddays Lv 1 18 pts. 9,384
  6. Avatar for alwen 46. alwen Lv 1 17 pts. 9,368
  7. Avatar for phi16 47. phi16 Lv 1 16 pts. 9,364
  8. Avatar for MrZanav 48. MrZanav Lv 1 15 pts. 9,337
  9. Avatar for heather-1 49. heather-1 Lv 1 15 pts. 9,320
  10. Avatar for Blipperman 50. Blipperman Lv 1 14 pts. 9,319

Comments