Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,842
  2. Avatar for Go Science 2. Go Science 73 pts. 9,819
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,775
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,765
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,729
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,722
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,650
  8. Avatar for Contenders 8. Contenders 6 pts. 9,591
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 9,550
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,262
  1. Avatar for aznarog 41. aznarog Lv 1 21 pts. 9,445
  2. Avatar for Silvercraft 42. Silvercraft Lv 1 20 pts. 9,430
  3. Avatar for jausmh 43. jausmh Lv 1 19 pts. 9,410
  4. Avatar for Vinara 44. Vinara Lv 1 18 pts. 9,390
  5. Avatar for diamonddays 45. diamonddays Lv 1 18 pts. 9,384
  6. Avatar for alwen 46. alwen Lv 1 17 pts. 9,368
  7. Avatar for phi16 47. phi16 Lv 1 16 pts. 9,364
  8. Avatar for MrZanav 48. MrZanav Lv 1 15 pts. 9,337
  9. Avatar for heather-1 49. heather-1 Lv 1 15 pts. 9,320
  10. Avatar for Blipperman 50. Blipperman Lv 1 14 pts. 9,319

Comments