Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 8,950
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,541
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 8,508
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,381
  5. Avatar for Russian team 15. Russian team 1 pt. 8,236
  6. Avatar for Deleted group 17. Deleted group pts. 0

  1. Avatar for kathy65 81. kathy65 Lv 1 3 pts. 8,675
  2. Avatar for navn 82. navn Lv 1 2 pts. 8,665
  3. Avatar for VerbisViVi 83. VerbisViVi Lv 1 2 pts. 8,647
  4. Avatar for kevin everington 84. kevin everington Lv 1 2 pts. 8,643
  5. Avatar for brockstar113 85. brockstar113 Lv 1 2 pts. 8,626
  6. Avatar for Marian90 86. Marian90 Lv 1 2 pts. 8,612
  7. Avatar for detectorist 87. detectorist Lv 1 2 pts. 8,598
  8. Avatar for Amitron 88. Amitron Lv 1 2 pts. 8,589
  9. Avatar for tamanrasset 89. tamanrasset Lv 1 2 pts. 8,573
  10. Avatar for harvardman 90. harvardman Lv 1 2 pts. 8,555

Comments