Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,842
  2. Avatar for Go Science 2. Go Science 73 pts. 9,819
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,775
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,765
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,729
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,722
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,650
  8. Avatar for Contenders 8. Contenders 6 pts. 9,591
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 9,550
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,262
  1. Avatar for kathy65 81. kathy65 Lv 1 3 pts. 8,675
  2. Avatar for navn 82. navn Lv 1 2 pts. 8,665
  3. Avatar for VerbisViVi 83. VerbisViVi Lv 1 2 pts. 8,647
  4. Avatar for kevin everington 84. kevin everington Lv 1 2 pts. 8,643
  5. Avatar for brockstar113 85. brockstar113 Lv 1 2 pts. 8,626
  6. Avatar for Marian90 86. Marian90 Lv 1 2 pts. 8,612
  7. Avatar for detectorist 87. detectorist Lv 1 2 pts. 8,598
  8. Avatar for Amitron 88. Amitron Lv 1 2 pts. 8,589
  9. Avatar for tamanrasset 89. tamanrasset Lv 1 2 pts. 8,573
  10. Avatar for harvardman 90. harvardman Lv 1 2 pts. 8,555

Comments