Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360
  1. Avatar for Martael 131. Martael Lv 1 9 pts. 9,470
  2. Avatar for kitek314_pl 132. kitek314_pl Lv 1 9 pts. 9,458
  3. Avatar for Midinia 133. Midinia Lv 1 9 pts. 9,439
  4. Avatar for Nickall 134. Nickall Lv 1 8 pts. 9,439
  5. Avatar for husky1970 135. husky1970 Lv 1 8 pts. 9,427
  6. Avatar for oaks 136. oaks Lv 1 8 pts. 9,426
  7. Avatar for bcd 137. bcd Lv 1 8 pts. 9,398
  8. Avatar for wildone4444 138. wildone4444 Lv 1 8 pts. 9,395
  9. Avatar for Chris K 139. Chris K Lv 1 7 pts. 9,391
  10. Avatar for SergeyFox 140. SergeyFox Lv 1 7 pts. 9,378

Comments