Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360
  1. Avatar for jstaxton 141. jstaxton Lv 1 7 pts. 9,373
  2. Avatar for Raniru1 142. Raniru1 Lv 1 7 pts. 9,354
  3. Avatar for fearjuan 143. fearjuan Lv 1 7 pts. 9,343
  4. Avatar for tlaran 144. tlaran Lv 1 7 pts. 9,327
  5. Avatar for TmLu 145. TmLu Lv 1 6 pts. 9,324
  6. Avatar for stexx 146. stexx Lv 1 6 pts. 9,323
  7. Avatar for shtef12 147. shtef12 Lv 1 6 pts. 9,315
  8. Avatar for pente_player 148. pente_player Lv 1 6 pts. 9,312
  9. Avatar for micdifo 149. micdifo Lv 1 6 pts. 9,311
  10. Avatar for Frank01 150. Frank01 Lv 1 6 pts. 9,304

Comments