Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360
  1. Avatar for haabermaaster 51. haabermaaster Lv 1 45 pts. 10,270
  2. Avatar for hansvandenhof 52. hansvandenhof Lv 1 44 pts. 10,252
  3. Avatar for WBarme1234 53. WBarme1234 Lv 1 43 pts. 10,246
  4. Avatar for Glen B 54. Glen B Lv 1 43 pts. 10,244
  5. Avatar for Pawel Tluscik 55. Pawel Tluscik Lv 1 42 pts. 10,222
  6. Avatar for wosser1 56. wosser1 Lv 1 41 pts. 10,213
  7. Avatar for heather-1 57. heather-1 Lv 1 40 pts. 10,199
  8. Avatar for johngran 58. johngran Lv 1 40 pts. 10,187
  9. Avatar for Scopper 59. Scopper Lv 1 39 pts. 10,186
  10. Avatar for badbunisbad 60. badbunisbad Lv 1 38 pts. 10,165

Comments