Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467
  1. Avatar for Daodunu 251. Daodunu Lv 1 1 pt. 8,664
  2. Avatar for alienx 252. alienx Lv 1 1 pt. 8,659
  3. Avatar for BigDennis 253. BigDennis Lv 1 1 pt. 8,653
  4. Avatar for WoutSCC 254. WoutSCC Lv 1 1 pt. 8,647
  5. Avatar for Mickataef 255. Mickataef Lv 1 1 pt. 8,646
  6. Avatar for Knuspy 256. Knuspy Lv 1 1 pt. 8,644
  7. Avatar for YellowBearPL 257. YellowBearPL Lv 1 1 pt. 8,642
  8. Avatar for rizkyh.m 258. rizkyh.m Lv 1 1 pt. 8,640
  9. Avatar for yunifay 259. yunifay Lv 1 1 pt. 8,640
  10. Avatar for Mahalippi 260. Mahalippi Lv 1 1 pt. 8,639

Comments