Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467

  1. Avatar for Ikuso 61. Ikuso Lv 1 43 pts. 10,137
  2. Avatar for CAN1958 62. CAN1958 Lv 1 42 pts. 10,128
  3. Avatar for drumpeter18yrs9yrs 63. drumpeter18yrs9yrs Lv 1 41 pts. 10,102
  4. Avatar for Arne Heessels 64. Arne Heessels Lv 1 41 pts. 10,101
  5. Avatar for Biochemica 65. Biochemica Lv 1 40 pts. 10,101
  6. Avatar for ComputerMage 66. ComputerMage Lv 1 40 pts. 10,096
  7. Avatar for ManVsYard 67. ManVsYard Lv 1 39 pts. 10,095
  8. Avatar for infjamc 68. infjamc Lv 1 38 pts. 10,075
  9. Avatar for pmthomson90 69. pmthomson90 Lv 1 38 pts. 10,064
  10. Avatar for Pawel Tluscik 70. Pawel Tluscik Lv 1 37 pts. 10,058

Comments