Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 6 pts. 10,810
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 4 pts. 10,664
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 10,448
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 10,412
  5. Avatar for Russian team 15. Russian team 1 pt. 10,353
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,823
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 9,808
  8. Avatar for Chem Eng Thermo 18. Chem Eng Thermo 1 pt. 9,687
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,502
  10. Avatar for Australia 20. Australia 1 pt. 9,342
  1. Avatar for deathbat_87 241. deathbat_87 Lv 1 1 pt. 8,860
  2. Avatar for p34t 242. p34t Lv 1 1 pt. 8,856
  3. Avatar for CosmoGini 243. CosmoGini Lv 1 1 pt. 8,855
  4. Avatar for jsmith86 244. jsmith86 Lv 1 1 pt. 8,846
  5. Avatar for MephistoMUC 245. MephistoMUC Lv 1 1 pt. 8,788
  6. Avatar for Slubber 246. Slubber Lv 1 1 pt. 8,665
  7. Avatar for Auntecedent 247. Auntecedent Lv 1 1 pt. 8,627
  8. Avatar for MiguelRI 248. MiguelRI Lv 1 1 pt. 8,612
  9. Avatar for Michael_is_folding 249. Michael_is_folding Lv 1 1 pt. 8,594
  10. Avatar for thor0385 250. thor0385 Lv 1 1 pt. 8,494

Comments