Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866
  1. Avatar for deathbat_87 241. deathbat_87 Lv 1 1 pt. 8,860
  2. Avatar for p34t 242. p34t Lv 1 1 pt. 8,856
  3. Avatar for CosmoGini 243. CosmoGini Lv 1 1 pt. 8,855
  4. Avatar for jsmith86 244. jsmith86 Lv 1 1 pt. 8,846
  5. Avatar for MephistoMUC 245. MephistoMUC Lv 1 1 pt. 8,788
  6. Avatar for Slubber 246. Slubber Lv 1 1 pt. 8,665
  7. Avatar for Auntecedent 247. Auntecedent Lv 1 1 pt. 8,627
  8. Avatar for MiguelRI 248. MiguelRI Lv 1 1 pt. 8,612
  9. Avatar for Michael_is_folding 249. Michael_is_folding Lv 1 1 pt. 8,594
  10. Avatar for thor0385 250. thor0385 Lv 1 1 pt. 8,494

Comments