Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 6 pts. 10,810
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 4 pts. 10,664
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 10,448
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 10,412
  5. Avatar for Russian team 15. Russian team 1 pt. 10,353
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,823
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 9,808
  8. Avatar for Chem Eng Thermo 18. Chem Eng Thermo 1 pt. 9,687
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,502
  10. Avatar for Australia 20. Australia 1 pt. 9,342
  1. Avatar for drjr 271. drjr Lv 1 1 pt. 6,348
  2. Avatar for PMcShea 272. PMcShea Lv 1 1 pt. 6,348
  3. Avatar for spmm 273. spmm Lv 1 1 pt. 6,348
  4. Avatar for yuanfen 274. yuanfen Lv 1 1 pt. 6,348
  5. Avatar for puxatudo 275. puxatudo Lv 1 1 pt. 6,348
  6. Avatar for momadoc 276. momadoc Lv 1 1 pt. 6,348
  7. Avatar for Philine 277. Philine Lv 1 1 pt. 6,348
  8. Avatar for ViolaStras 278. ViolaStras Lv 1 1 pt. 6,348
  9. Avatar for RockOn 279. RockOn Lv 1 1 pt. 6,348
  10. Avatar for meatexplosion 280. meatexplosion Lv 1 1 pt. 6,348

Comments