Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866

  1. Avatar for drjr 271. drjr Lv 1 1 pt. 6,348
  2. Avatar for PMcShea 272. PMcShea Lv 1 1 pt. 6,348
  3. Avatar for spmm 273. spmm Lv 1 1 pt. 6,348
  4. Avatar for yuanfen 274. yuanfen Lv 1 1 pt. 6,348
  5. Avatar for puxatudo 275. puxatudo Lv 1 1 pt. 6,348
  6. Avatar for momadoc 276. momadoc Lv 1 1 pt. 6,348
  7. Avatar for Philine 277. Philine Lv 1 1 pt. 6,348
  8. Avatar for ViolaStras 278. ViolaStras Lv 1 1 pt. 6,348
  9. Avatar for RockOn 279. RockOn Lv 1 1 pt. 6,348
  10. Avatar for meatexplosion 280. meatexplosion Lv 1 1 pt. 6,348

Comments