Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 6 pts. 10,810
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 4 pts. 10,664
  3. Avatar for BOINC@Poland 13. BOINC@Poland 3 pts. 10,448
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 10,412
  5. Avatar for Russian team 15. Russian team 1 pt. 10,353
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,823
  7. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 9,808
  8. Avatar for Chem Eng Thermo 18. Chem Eng Thermo 1 pt. 9,687
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,502
  10. Avatar for Australia 20. Australia 1 pt. 9,342

  1. Avatar for alwen 51. alwen Lv 1 38 pts. 10,693
  2. Avatar for pvc78 52. pvc78 Lv 1 38 pts. 10,690
  3. Avatar for heather-1 53. heather-1 Lv 1 37 pts. 10,672
  4. Avatar for Satina 54. Satina Lv 1 36 pts. 10,664
  5. Avatar for wboler 55. wboler Lv 1 35 pts. 10,662
  6. Avatar for knotartist 56. knotartist Lv 1 34 pts. 10,656
  7. Avatar for Crossed Sticks 57. Crossed Sticks Lv 1 34 pts. 10,648
  8. Avatar for FractalCuber 58. FractalCuber Lv 1 33 pts. 10,646
  9. Avatar for wudoo 59. wudoo Lv 1 32 pts. 10,642
  10. Avatar for ichwilldiesennamen 60. ichwilldiesennamen Lv 1 32 pts. 10,639

Comments