Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866

  1. Avatar for alwen 51. alwen Lv 1 38 pts. 10,693
  2. Avatar for pvc78 52. pvc78 Lv 1 38 pts. 10,690
  3. Avatar for heather-1 53. heather-1 Lv 1 37 pts. 10,672
  4. Avatar for Satina 54. Satina Lv 1 36 pts. 10,664
  5. Avatar for wboler 55. wboler Lv 1 35 pts. 10,662
  6. Avatar for knotartist 56. knotartist Lv 1 34 pts. 10,656
  7. Avatar for Crossed Sticks 57. Crossed Sticks Lv 1 34 pts. 10,648
  8. Avatar for FractalCuber 58. FractalCuber Lv 1 33 pts. 10,646
  9. Avatar for wudoo 59. wudoo Lv 1 32 pts. 10,642
  10. Avatar for ichwilldiesennamen 60. ichwilldiesennamen Lv 1 32 pts. 10,639

Comments