Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for Trajan464 121. Trajan464 Lv 1 7 pts. 9,812
  2. Avatar for pmlkjn 122. pmlkjn Lv 1 7 pts. 9,808
  3. Avatar for rezaefar 123. rezaefar Lv 1 6 pts. 9,796
  4. Avatar for nathalie friess salido 124. nathalie friess salido Lv 1 6 pts. 9,764
  5. Avatar for pente_player 125. pente_player Lv 1 6 pts. 9,751
  6. Avatar for abiogenesis 126. abiogenesis Lv 1 6 pts. 9,745
  7. Avatar for harvardman 127. harvardman Lv 1 6 pts. 9,745
  8. Avatar for tom2705 128. tom2705 Lv 1 6 pts. 9,742
  9. Avatar for bcre8tvv 129. bcre8tvv Lv 1 5 pts. 9,739
  10. Avatar for darixchel 130. darixchel Lv 1 5 pts. 9,734

Comments