Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for JasperD 131. JasperD Lv 1 5 pts. 9,732
  2. Avatar for pangaena 132. pangaena Lv 1 5 pts. 9,732
  3. Avatar for not_publius 133. not_publius Lv 1 5 pts. 9,726
  4. Avatar for Arne Heessels 134. Arne Heessels Lv 1 5 pts. 9,707
  5. Avatar for Trematode1980 135. Trematode1980 Lv 1 5 pts. 9,700
  6. Avatar for rabamino12358 136. rabamino12358 Lv 1 4 pts. 9,699
  7. Avatar for G d S 137. G d S Lv 1 4 pts. 9,687
  8. Avatar for Altercomp 138. Altercomp Lv 1 4 pts. 9,675
  9. Avatar for bstolz 139. bstolz Lv 1 4 pts. 9,670
  10. Avatar for dahast.de 140. dahast.de Lv 1 4 pts. 9,664

Comments