Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for cjddig 141. cjddig Lv 1 4 pts. 9,663
  2. Avatar for fearjuan 142. fearjuan Lv 1 4 pts. 9,657
  3. Avatar for EagleGuy 143. EagleGuy Lv 1 4 pts. 9,650
  4. Avatar for Dhalion 144. Dhalion Lv 1 3 pts. 9,645
  5. Avatar for fisherlr777 145. fisherlr777 Lv 1 3 pts. 9,627
  6. Avatar for zannipietro 146. zannipietro Lv 1 3 pts. 9,624
  7. Avatar for jawz101 147. jawz101 Lv 1 3 pts. 9,610
  8. Avatar for fanchunhui 148. fanchunhui Lv 1 3 pts. 9,591
  9. Avatar for cinnamonkitty 149. cinnamonkitty Lv 1 3 pts. 9,590
  10. Avatar for ester141 150. ester141 Lv 1 3 pts. 9,590

Comments