Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for deconstruct 161. deconstruct Lv 1 2 pts. 9,483
  2. Avatar for steveB 162. steveB Lv 1 2 pts. 9,480
  3. Avatar for Chris Klassen 163. Chris Klassen Lv 1 2 pts. 9,455
  4. Avatar for sitlux 164. sitlux Lv 1 2 pts. 9,451
  5. Avatar for jsfoldingaccount 165. jsfoldingaccount Lv 1 2 pts. 9,450
  6. Avatar for tlai 166. tlai Lv 1 2 pts. 9,444
  7. Avatar for xabxs 167. xabxs Lv 1 2 pts. 9,437
  8. Avatar for Hum 168. Hum Lv 1 2 pts. 9,434
  9. Avatar for dfonda 169. dfonda Lv 1 2 pts. 9,410
  10. Avatar for Slense 170. Slense Lv 1 2 pts. 9,376

Comments