Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for Pazithi 171. Pazithi Lv 1 2 pts. 9,367
  2. Avatar for SKSbell 172. SKSbell Lv 1 1 pt. 9,367
  3. Avatar for SWR_DMaster 173. SWR_DMaster Lv 1 1 pt. 9,346
  4. Avatar for ExcitableMonkey 174. ExcitableMonkey Lv 1 1 pt. 9,342
  5. Avatar for Dr.Sillem 175. Dr.Sillem Lv 1 1 pt. 9,340
  6. Avatar for RiaSkies 176. RiaSkies Lv 1 1 pt. 9,334
  7. Avatar for Deleted player 177. Deleted player pts. 9,324
  8. Avatar for ClueEmol 178. ClueEmol Lv 1 1 pt. 9,316
  9. Avatar for RetromanV3377 179. RetromanV3377 Lv 1 1 pt. 9,311
  10. Avatar for Lotus23 180. Lotus23 Lv 1 1 pt. 9,300

Comments