Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for Mike Lewis 181. Mike Lewis Lv 1 1 pt. 9,269
  2. Avatar for Orkman 182. Orkman Lv 1 1 pt. 9,262
  3. Avatar for kevin everington 183. kevin everington Lv 1 1 pt. 9,258
  4. Avatar for Willyanto 184. Willyanto Lv 1 1 pt. 9,255
  5. Avatar for kludbrook 185. kludbrook Lv 1 1 pt. 9,243
  6. Avatar for immerdasgleiche 186. immerdasgleiche Lv 1 1 pt. 9,243
  7. Avatar for IIIoB 187. IIIoB Lv 1 1 pt. 9,239
  8. Avatar for mikemarkelov 188. mikemarkelov Lv 1 1 pt. 9,223
  9. Avatar for Caraline_nelson 189. Caraline_nelson Lv 1 1 pt. 9,214
  10. Avatar for Jenot96 190. Jenot96 Lv 1 1 pt. 9,209

Comments