Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 84 pts. 11,115
  2. Avatar for LastAndroid 12. LastAndroid Lv 1 83 pts. 11,080
  3. Avatar for Phyx 13. Phyx Lv 1 81 pts. 11,076
  4. Avatar for Formula350 14. Formula350 Lv 1 80 pts. 11,070
  5. Avatar for Deleted player 15. Deleted player pts. 11,066
  6. Avatar for mirp 16. mirp Lv 1 77 pts. 11,064
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 75 pts. 11,034
  8. Avatar for Deleted player 18. Deleted player 74 pts. 11,023
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 72 pts. 11,020
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 71 pts. 11,013

Comments