Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for YellowBearPL 201. YellowBearPL Lv 1 1 pt. 9,120
  2. Avatar for Funkypower 202. Funkypower Lv 1 1 pt. 9,120
  3. Avatar for ProfVince 203. ProfVince Lv 1 1 pt. 9,117
  4. Avatar for hbienert 204. hbienert Lv 1 1 pt. 9,116
  5. Avatar for GAVENvonAHYO 205. GAVENvonAHYO Lv 1 1 pt. 9,112
  6. Avatar for JonVose 206. JonVose Lv 1 1 pt. 9,110
  7. Avatar for foldithl1 207. foldithl1 Lv 1 1 pt. 9,107
  8. Avatar for gesslese 208. gesslese Lv 1 1 pt. 9,098
  9. Avatar for lwelite 209. lwelite Lv 1 1 pt. 9,088
  10. Avatar for leodre 210. leodre Lv 1 1 pt. 9,079

Comments