Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348

  1. Avatar for DH5alpha 211. DH5alpha Lv 1 1 pt. 9,078
  2. Avatar for tombickle 212. tombickle Lv 1 1 pt. 9,078
  3. Avatar for Datstandin 213. Datstandin Lv 1 1 pt. 9,075
  4. Avatar for Deleted player 214. Deleted player 1 pt. 9,072
  5. Avatar for lilovip 215. lilovip Lv 1 1 pt. 9,070
  6. Avatar for LELE1964 216. LELE1964 Lv 1 1 pt. 9,070
  7. Avatar for thiagomaia 217. thiagomaia Lv 1 1 pt. 9,068
  8. Avatar for dcherrmann 218. dcherrmann Lv 1 1 pt. 9,065
  9. Avatar for hajtogato 219. hajtogato Lv 1 1 pt. 9,065
  10. Avatar for sabber 220. sabber Lv 1 1 pt. 9,064

Comments