Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for ahernandez25 231. ahernandez25 Lv 1 1 pt. 8,982
  2. Avatar for Ines_Bichon 232. Ines_Bichon Lv 1 1 pt. 8,982
  3. Avatar for jlucero29 233. jlucero29 Lv 1 1 pt. 8,981
  4. Avatar for MicheleVerret 234. MicheleVerret Lv 1 1 pt. 8,963
  5. Avatar for rfeind9 235. rfeind9 Lv 1 1 pt. 8,919
  6. Avatar for MaxR4 236. MaxR4 Lv 1 1 pt. 8,905
  7. Avatar for Irgendwer 237. Irgendwer Lv 1 1 pt. 8,899
  8. Avatar for Hiko N. 238. Hiko N. Lv 1 1 pt. 8,890
  9. Avatar for 3344 239. 3344 Lv 1 1 pt. 8,888
  10. Avatar for skovz99 240. skovz99 Lv 1 1 pt. 8,860

Comments