Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for schwanda 251. schwanda Lv 1 1 pt. 8,447
  2. Avatar for Kornl 252. Kornl Lv 1 1 pt. 8,428
  3. Avatar for mmudgett 253. mmudgett Lv 1 1 pt. 8,412
  4. Avatar for bkoep 254. bkoep Lv 1 1 pt. 8,411
  5. Avatar for AshlynnT 255. AshlynnT Lv 1 1 pt. 8,324
  6. Avatar for 9racoon 256. 9racoon Lv 1 1 pt. 8,315
  7. Avatar for TheGUmmer 257. TheGUmmer Lv 1 1 pt. 8,232
  8. Avatar for Maxlife1234 258. Maxlife1234 Lv 1 1 pt. 8,202
  9. Avatar for monichen50 259. monichen50 Lv 1 1 pt. 8,114
  10. Avatar for petetrig 260. petetrig Lv 1 1 pt. 8,039

Comments