Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for phi16 21. phi16 Lv 1 70 pts. 11,013
  2. Avatar for CharlieFortsConscience 22. CharlieFortsConscience Lv 1 69 pts. 11,009
  3. Avatar for jobo0502 23. jobo0502 Lv 1 67 pts. 11,006
  4. Avatar for inhtih 24. inhtih Lv 1 66 pts. 11,002
  5. Avatar for marsfan 25. marsfan Lv 1 65 pts. 10,997
  6. Avatar for TurtleByte 26. TurtleByte Lv 1 63 pts. 10,976
  7. Avatar for Blipperman 27. Blipperman Lv 1 62 pts. 10,972
  8. Avatar for Scopper 28. Scopper Lv 1 61 pts. 10,971
  9. Avatar for Joanna_H 29. Joanna_H Lv 1 60 pts. 10,967
  10. Avatar for robgee 30. robgee Lv 1 59 pts. 10,960

Comments