Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for g_b 31. g_b Lv 1 58 pts. 10,945
  2. Avatar for Jpilkington 32. Jpilkington Lv 1 56 pts. 10,919
  3. Avatar for TECHFREAK 33. TECHFREAK Lv 1 55 pts. 10,907
  4. Avatar for silent gene 34. silent gene Lv 1 54 pts. 10,891
  5. Avatar for Steven Pletsch 35. Steven Pletsch Lv 1 53 pts. 10,866
  6. Avatar for Mikisp 36. Mikisp Lv 1 52 pts. 10,856
  7. Avatar for KarenCH 37. KarenCH Lv 1 51 pts. 10,855
  8. Avatar for alcor29 38. alcor29 Lv 1 50 pts. 10,853
  9. Avatar for aznarog 39. aznarog Lv 1 49 pts. 10,832
  10. Avatar for georg137 40. georg137 Lv 1 48 pts. 10,816

Comments