Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for spdenne 41. spdenne Lv 1 47 pts. 10,810
  2. Avatar for Xartos 42. Xartos Lv 1 46 pts. 10,793
  3. Avatar for Timo van der Laan 43. Timo van der Laan Lv 1 45 pts. 10,783
  4. Avatar for Karlheinz 44. Karlheinz Lv 1 44 pts. 10,771
  5. Avatar for Ignacio 45. Ignacio Lv 1 43 pts. 10,748
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 43 pts. 10,744
  7. Avatar for Vman 47. Vman Lv 1 42 pts. 10,723
  8. Avatar for Idiotboy 48. Idiotboy Lv 1 41 pts. 10,718
  9. Avatar for stomjoh 49. stomjoh Lv 1 40 pts. 10,703
  10. Avatar for NinjaGreg 50. NinjaGreg Lv 1 39 pts. 10,694

Comments