Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for Hellcat6 61. Hellcat6 Lv 1 31 pts. 10,631
  2. Avatar for infjamc 62. infjamc Lv 1 30 pts. 10,596
  3. Avatar for Pikkachurin 63. Pikkachurin Lv 1 30 pts. 10,596
  4. Avatar for fpc 64. fpc Lv 1 29 pts. 10,587
  5. Avatar for Anfinsen_slept_here 65. Anfinsen_slept_here Lv 1 28 pts. 10,550
  6. Avatar for Vinara 66. Vinara Lv 1 28 pts. 10,541
  7. Avatar for Flagg65a 67. Flagg65a Lv 1 27 pts. 10,519
  8. Avatar for jeff101 68. jeff101 Lv 1 26 pts. 10,516
  9. Avatar for TastyMunchies 69. TastyMunchies Lv 1 26 pts. 10,504
  10. Avatar for John McLeod 70. John McLeod Lv 1 25 pts. 10,474

Comments