Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Fox Folds 21. Fox Folds 1 pt. 9,110
  2. Avatar for hhv9 22. hhv9 1 pt. 9,107
  3. Avatar for NMHU Biol4230 Spr 20 23. NMHU Biol4230 Spr 20 1 pt. 9,048
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 6,348
  1. Avatar for diamonddays 81. diamonddays Lv 1 19 pts. 10,396
  2. Avatar for MrZanav 82. MrZanav Lv 1 19 pts. 10,376
  3. Avatar for RW-QuantumSec 83. RW-QuantumSec Lv 1 19 pts. 10,359
  4. Avatar for Gerom 84. Gerom Lv 1 18 pts. 10,353
  5. Avatar for HuubR 85. HuubR Lv 1 18 pts. 10,323
  6. Avatar for yaksari 86. yaksari Lv 1 17 pts. 10,276
  7. Avatar for Glen B 87. Glen B Lv 1 17 pts. 10,255
  8. Avatar for CAN1958 88. CAN1958 Lv 1 16 pts. 10,236
  9. Avatar for Philzord 89. Philzord Lv 1 16 pts. 10,228
  10. Avatar for kitek314_pl 90. kitek314_pl Lv 1 16 pts. 10,203

Comments