Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866
  1. Avatar for sciencewalker 111. sciencewalker Lv 1 9 pts. 9,930
  2. Avatar for MnSk 112. MnSk Lv 1 9 pts. 9,898
  3. Avatar for backterria 113. backterria Lv 1 9 pts. 9,887
  4. Avatar for Deleted player 114. Deleted player pts. 9,886
  5. Avatar for Pibeagles1 115. Pibeagles1 Lv 1 8 pts. 9,859
  6. Avatar for edpalas 116. edpalas Lv 1 8 pts. 9,849
  7. Avatar for Bucsan 117. Bucsan Lv 1 8 pts. 9,841
  8. Avatar for NPrincipi 118. NPrincipi Lv 1 7 pts. 9,826
  9. Avatar for gldisater 119. gldisater Lv 1 7 pts. 9,823
  10. Avatar for badgoes 120. badgoes Lv 1 7 pts. 9,821

Comments