Placeholder image of a protein
Icon representing a puzzle

1833: Revisiting Puzzle 114: Black Mamba

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 30, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,271
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 11,257
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 64 pts. 11,249
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 11,218
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 11,209
  6. Avatar for Penny-Arcade 6. Penny-Arcade 30 pts. 11,080
  7. Avatar for Contenders 7. Contenders 23 pts. 11,034
  8. Avatar for Marvin's bunch 8. Marvin's bunch 17 pts. 10,972
  9. Avatar for Team India 9. Team India 12 pts. 10,907
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 10,866
  1. Avatar for neon_fuzz 71. neon_fuzz Lv 1 25 pts. 10,472
  2. Avatar for Polarstern 72. Polarstern Lv 1 24 pts. 10,463
  3. Avatar for ShadowTactics 73. ShadowTactics Lv 1 24 pts. 10,448
  4. Avatar for Tygh 74. Tygh Lv 1 23 pts. 10,439
  5. Avatar for Blue102 75. Blue102 Lv 1 22 pts. 10,430
  6. Avatar for Merf 76. Merf Lv 1 22 pts. 10,429
  7. Avatar for Threeoak 77. Threeoak Lv 1 21 pts. 10,424
  8. Avatar for tangofox10 78. tangofox10 Lv 1 21 pts. 10,415
  9. Avatar for versat82 79. versat82 Lv 1 20 pts. 10,412
  10. Avatar for allie_heather47 80. allie_heather47 Lv 1 20 pts. 10,410

Comments